Lineage for d1kpmb_ (1kpm B:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) Protein Snake phospholipase A2 [48624] (18 species) 
Species Snake (Daboia russelli pulchella) [48630] (4 PDB entries) 
Domain d1kpmb_: 1kpm B: [72845]
Details for d1kpmb_
PDB Entry: 1kpm (more details), 1.8 Å
PDB Description: first structural evidence of a specific inhibition of phospholipase a2 by vitamin e and its implications in inflammation: crystal structure of the complex formed between phospholipase a2 and vitamin e at 1.8 a resolution.
SCOP Domain Sequences for d1kpmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpmb_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
SCOP Domain Coordinates for d1kpmb_:
Click to download the PDB-style file with coordinates for d1kpmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kpmb_:
- d1kpmb_ is new in SCOP 1.61
- d1kpmb_ appears in SCOP 1.63
- d1kpmb_ appears in the current release, SCOPe 2.08
View in 3D
