Lineage for d1kpma_ (1kpm A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156745Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 156746Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 156751Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 156820Protein Snake phospholipase A2 [48624] (18 species)
  7. 156888Species Snake (Daboia russelli pulchella) [48630] (4 PDB entries)
  8. 156891Domain d1kpma_: 1kpm A: [72844]

Details for d1kpma_

PDB Entry: 1kpm (more details), 1.8 Å

PDB Description: first structural evidence of a specific inhibition of phospholipase a2 by vitamin e and its implications in inflammation: crystal structure of the complex formed between phospholipase a2 and vitamin e at 1.8 a resolution.

SCOP Domain Sequences for d1kpma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpma_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d1kpma_:

Click to download the PDB-style file with coordinates for d1kpma_.
(The format of our PDB-style files is described here.)

Timeline for d1kpma_: