Lineage for d1kp3a2 (1kp3 A:189-446)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563173Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2563174Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2563175Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 protein domains)
  6. 2563176Protein Argininosuccinate synthetase, C-terminal domain [69866] (3 species)
  7. 2563177Species Escherichia coli [TaxId:562] [69867] (4 PDB entries)
  8. 2563181Domain d1kp3a2: 1kp3 A:189-446 [72841]
    Other proteins in same PDB: d1kp3a1
    complexed with atp, cir, gai, po4

Details for d1kp3a2

PDB Entry: 1kp3 (more details), 2 Å

PDB Description: Crystal Structure of E. coli Argininosuccinate Synthetase in Complex with ATP and Citrulline
PDB Compounds: (A:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1kp3a2:

Sequence, based on SEQRES records: (download)

>d1kp3a2 d.210.1.1 (A:189-446) Argininosuccinate synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
aystdsnmlgatheakdleylnssvkivnpimgvkfwdesvkipaeevtvrfeqghpval
ngktfsddvemmleanriggrhglgmsdqienriieaksrgiyeapgmallhiayerllt
gihnedtieqyhahgrqlgrllyqgrwfdsqalmlrdslqrwvasqitgevtlelrrgnd
ysilntvsenltykperltmekgdsvfspddrigqltmrnlditdtreklfgyaktglls
ssaasgvpqvenlenkgq

Sequence, based on observed residues (ATOM records): (download)

>d1kp3a2 d.210.1.1 (A:189-446) Argininosuccinate synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
aystdsnmlgatheakdleylnssvkivnpimgvkfwdesvkipaeevtvrfeqghpval
ngktfsddvemmleanriggrhglgmsdqienriieaksrgiyeapgmallhiayerllt
gihnedtieqyhahgrqlgrllyqgrwfdsqalmlrdslqrwvasqitgevtlelrrgnd
ysilntvsenltykpersvfspddrigqltmrnlditdtreklfgyaktgllsssaasgv
pqvenlenkgq

SCOPe Domain Coordinates for d1kp3a2:

Click to download the PDB-style file with coordinates for d1kp3a2.
(The format of our PDB-style files is described here.)

Timeline for d1kp3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kp3a1