SCOPe 2.08: Domain d1kp3a1: 1kp3 A:1-188

Lineage for d1kp3a1 (1kp3 A:1-188)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species)

7. Species Escherichia coli [TaxId:562] [69459] (4 PDB entries)

8. Domain d1kp3a1: 1kp3 A:1-188 [72840]
   Other proteins in same PDB: d1kp3a2
   complexed with atp, cir, gai, po4

Details for d1kp3a1

PDB Entry: 1kp3, 2 Å

PDB Description: Crystal Structure of E. coli Argininosuccinate Synthetase in Complex with ATP and Citrulline

PDB Compounds: (A:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1kp3a1:

Sequence; same for both SEQRES and ATOM records:

>d1kp3a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]}
ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
dykmsvek

Timeline for d1kp3a1:

• d1kp3a1 first appeared in SCOP 1.61
  
• d1kp3a1 appears in SCOPe 2.07