Lineage for d1kp2a1 (1kp2 A:1-188)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2106293Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2106294Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 protein domains)
  6. 2106295Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species)
  7. 2106296Species Escherichia coli [TaxId:562] [69459] (4 PDB entries)
  8. 2106299Domain d1kp2a1: 1kp2 A:1-188 [72838]
    Other proteins in same PDB: d1kp2a2
    complexed with atp, gai, po4

Details for d1kp2a1

PDB Entry: 1kp2 (more details), 2 Å

PDB Description: Crystal Structure of E. coli Argininosuccinate Synthetase in Complex with ATP
PDB Compounds: (A:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1kp2a1:

Sequence, based on SEQRES records: (download)

>d1kp2a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]}
ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
dykmsvek

Sequence, based on observed residues (ATOM records): (download)

>d1kp2a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]}
ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
dyek

SCOPe Domain Coordinates for d1kp2a1:

Click to download the PDB-style file with coordinates for d1kp2a1.
(The format of our PDB-style files is described here.)

Timeline for d1kp2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kp2a2