SCOP 1.67: Domain d1kord1: 1kor D:1-165

Lineage for d1kord1 (1kor D:1-165)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)

6. Protein Argininosuccinate synthetase, N-terminal domain [69458] (2 species)

7. Species Thermus thermophilus [TaxId:274] [75167] (7 PDB entries)

8. Domain d1kord1: 1kor D:1-165 [72830]
   Other proteins in same PDB: d1kora2, d1korb2, d1korc2, d1kord2
   complexed with anp, arg, sin

Details for d1kord1

PDB Entry: 1kor, 1.95 Å

PDB Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with inhibitors

SCOP Domain Sequences for d1kord1:

Sequence; same for both SEQRES and ATOM records:

>d1kord1 c.26.2.1 (D:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus}
mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvp

Timeline for d1kord1:

• d1kord1 first appeared in SCOP 1.61
  
• d1kord1 appears in SCOP 1.65
  
• d1kord1 appears in SCOP 1.69
  
• d1kord1 appears in the current release, SCOPe 2.08