SCOPe 2.02: Domain d1koge2: 1kog E:242-532

Lineage for d1koge2 (1kog E:242-532)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)

7. Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)

8. Domain d1koge2: 1kog E:242-532 [72814]
   Other proteins in same PDB: d1koga1, d1kogb1, d1kogc1, d1kogd1, d1koge1, d1kogf1, d1kogg1, d1kogh1
   protein/RNA complex; complexed with tsb, zn

Details for d1koge2

PDB Entry: 1kog, 3.5 Å

PDB Description: Crystal structure of E. coli threonyl-tRNA synthetase interacting with the essential domain of its mRNA operator

PDB Compounds: (E:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1koge2:

Sequence; same for both SEQRES and ATOM records:

>d1koge2 d.104.1.1 (E:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

Timeline for d1koge2:

• d1koge2 first appeared in SCOP 1.61
  
• d1koge2 appears in SCOPe 2.01
  
• d1koge2 appears in SCOPe 2.03
  
• d1koge2 appears in the current release, SCOPe 2.08