Lineage for d1koge2 (1kog E:242-532)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416610Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 416611Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 416612Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins)
  6. 416761Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)
  7. 416762Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)
  8. 416776Domain d1koge2: 1kog E:242-532 [72814]
    Other proteins in same PDB: d1koga1, d1kogb1, d1kogc1, d1kogd1, d1koge1, d1kogf1, d1kogg1, d1kogh1

Details for d1koge2

PDB Entry: 1kog (more details), 3.5 Å

PDB Description: Crystal structure of E. coli threonyl-tRNA synthetase interacting with the essential domain of its mRNA operator

SCOP Domain Sequences for d1koge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koge2 d.104.1.1 (E:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOP Domain Coordinates for d1koge2:

Click to download the PDB-style file with coordinates for d1koge2.
(The format of our PDB-style files is described here.)

Timeline for d1koge2: