Lineage for d1koge1 (1kog E:533-642)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489768Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2489855Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)
  7. 2489856Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)
  8. 2489870Domain d1koge1: 1kog E:533-642 [72813]
    Other proteins in same PDB: d1koga2, d1kogb2, d1kogc2, d1kogd2, d1koge2, d1kogf2, d1kogg2, d1kogh2
    a truncated form of the enzyme
    protein/RNA complex; complexed with tsb, zn

Details for d1koge1

PDB Entry: 1kog (more details), 3.5 Å

PDB Description: Crystal structure of E. coli threonyl-tRNA synthetase interacting with the essential domain of its mRNA operator
PDB Compounds: (E:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1koge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koge1 c.51.1.1 (E:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

SCOPe Domain Coordinates for d1koge1:

Click to download the PDB-style file with coordinates for d1koge1.
(The format of our PDB-style files is described here.)

Timeline for d1koge1: