SCOP 1.67: Domain d1koge1: 1kog E:533-642

Lineage for d1koge1 (1kog E:533-642)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)

7. Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)

8. Domain d1koge1: 1kog E:533-642 [72813]
   Other proteins in same PDB: d1koga2, d1kogb2, d1kogc2, d1kogd2, d1koge2, d1kogf2, d1kogg2, d1kogh2

Details for d1koge1

PDB Entry: 1kog, 3.5 Å

PDB Description: Crystal structure of E. coli threonyl-tRNA synthetase interacting with the essential domain of its mRNA operator

SCOP Domain Sequences for d1koge1:

Sequence; same for both SEQRES and ATOM records:

>d1koge1 c.51.1.1 (E:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

Timeline for d1koge1:

• d1koge1 first appeared in SCOP 1.61
  
• d1koge1 appears in SCOP 1.65
  
• d1koge1 appears in SCOP 1.69
  
• d1koge1 appears in the current release, SCOPe 2.08