![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) ![]() |
![]() | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
![]() | Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [52963] (5 PDB entries) |
![]() | Domain d1koge1: 1kog E:533-642 [72813] Other proteins in same PDB: d1koga2, d1kogb2, d1kogc2, d1kogd2, d1koge2, d1kogf2, d1kogg2, d1kogh2 a truncated form of the enzyme protein/RNA complex; complexed with tsb, zn |
PDB Entry: 1kog (more details), 3.5 Å
SCOPe Domain Sequences for d1koge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1koge1 c.51.1.1 (E:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]} fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
Timeline for d1koge1: