Lineage for d1koga2 (1kog A:242-532)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426347Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1426348Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1426349Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1426549Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)
  7. 1426550Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)
  8. 1426560Domain d1koga2: 1kog A:242-532 [72806]
    Other proteins in same PDB: d1koga1, d1kogb1, d1kogc1, d1kogd1, d1koge1, d1kogf1, d1kogg1, d1kogh1
    protein/RNA complex; complexed with tsb, zn

Details for d1koga2

PDB Entry: 1kog (more details), 3.5 Å

PDB Description: Crystal structure of E. coli threonyl-tRNA synthetase interacting with the essential domain of its mRNA operator
PDB Compounds: (A:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1koga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koga2 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOPe Domain Coordinates for d1koga2:

Click to download the PDB-style file with coordinates for d1koga2.
(The format of our PDB-style files is described here.)

Timeline for d1koga2: