SCOPe 2.05: Domain d1kofb_: 1kof B:

Lineage for d1kofb_ (1kof B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.17: Gluconate kinase [75195] (1 protein)
   similar to the nucleotide/nucleoside kinases
   automatically mapped to Pfam PF01202

6. Protein Gluconate kinase [75196] (1 species)

7. Species Escherichia coli [TaxId:562] [75197] (6 PDB entries)

8. Domain d1kofb_: 1kof B: [72804]
   complexed with acp, mg

Details for d1kofb_

PDB Entry: 1kof, 2.8 Å

PDB Description: crystal structure of gluconate kinase

PDB Compounds: (B:) Gluconate kinase

SCOPe Domain Sequences for d1kofb_:

Sequence; same for both SEQRES and ATOM records:

>d1kofb_ c.37.1.17 (B:) Gluconate kinase {Escherichia coli [TaxId: 562]}
ttnhdhhiyvlmgvsgsgksavasevahqlhaafldgdflhprrniekmasgeplndddr
kpwlqalndaafamqrtnkvslivcsalkkhyrdllregnpnlsfiylkgdfdviesrlk
arkghffktqmlvtqfetlqepgadetdvlvvdidqplegvvastievikk

Timeline for d1kofb_:

• d1kofb_ first appeared in SCOP 1.61
  
• d1kofb_ appears in SCOPe 2.04
  
• d1kofb_ appears in SCOPe 2.06
  
• d1kofb_ appears in the current release, SCOPe 2.08