Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.17: Gluconate kinase [75195] (1 protein) similar to the nucleotide/nucleoside kinases |
Protein Gluconate kinase [75196] (1 species) |
Species Escherichia coli [TaxId:562] [75197] (6 PDB entries) |
Domain d1kofb_: 1kof B: [72804] complexed with acp, mg |
PDB Entry: 1kof (more details), 2.8 Å
SCOP Domain Sequences for d1kofb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kofb_ c.37.1.17 (B:) Gluconate kinase {Escherichia coli} ttnhdhhiyvlmgvsgsgksavasevahqlhaafldgdflhprrniekmasgeplndddr kpwlqalndaafamqrtnkvslivcsalkkhyrdllregnpnlsfiylkgdfdviesrlk arkghffktqmlvtqfetlqepgadetdvlvvdidqplegvvastievikk
Timeline for d1kofb_: