Lineage for d1ko7a2 (1ko7 A:130-298)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912052Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2912053Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2912166Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
    automatically mapped to Pfam PF07475
  6. 2912167Protein HPr kinase HprK C-terminal domain [64187] (3 species)
  7. 2912195Species Staphylococcus xylosus [TaxId:1288] [75326] (1 PDB entry)
  8. 2912196Domain d1ko7a2: 1ko7 A:130-298 [72798]
    Other proteins in same PDB: d1ko7a1, d1ko7b1
    complexed with po4

Details for d1ko7a2

PDB Entry: 1ko7 (more details), 1.95 Å

PDB Description: x-ray structure of the hpr kinase/phosphatase from staphylococcus xylosus at 1.95 a resolution
PDB Compounds: (A:) Hpr kinase/phosphatase

SCOPe Domain Sequences for d1ko7a2:

Sequence, based on SEQRES records: (download)

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}
arttslhgvlvdvygvgvlitgdsgigksetalelikrghrlvaddnveireiskdelig
rapkliehlleirglgiinvmtlfgagsiltekrlrlnihlenwhkeklydrvglneetl
rildteitkktipvrpgrnvaviievaamnyrlnimgintaeefndrln

Sequence, based on observed residues (ATOM records): (download)

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}
arttslhgvlvdvygvgvlitgdsgigksetalelikrghrlvaddnveireiskdelig
rapkliehlleirglgiinvmtlfgagsiltekrlrlnihleneetlrildteitkktip
vrpgrnvaviievaamnyrlnimgintaeefndrln

SCOPe Domain Coordinates for d1ko7a2:

Click to download the PDB-style file with coordinates for d1ko7a2.
(The format of our PDB-style files is described here.)

Timeline for d1ko7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ko7a1