Lineage for d1knra3 (1knr A:238-353)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264398Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 264399Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 264400Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 264450Protein L-aspartate oxidase [56427] (1 species)
  7. 264451Species Escherichia coli [TaxId:562] [56428] (3 PDB entries)
  8. 264453Domain d1knra3: 1knr A:238-353 [72790]
    Other proteins in same PDB: d1knra1, d1knra2
    complexed with cl, fad, na; mutant

Details for d1knra3

PDB Entry: 1knr (more details), 2.5 Å

PDB Description: l-aspartate oxidase: r386l mutant

SCOP Domain Sequences for d1knra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knra3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli}
lefnqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivarai
dhemkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahyt

SCOP Domain Coordinates for d1knra3:

Click to download the PDB-style file with coordinates for d1knra3.
(The format of our PDB-style files is described here.)

Timeline for d1knra3: