Lineage for d1knra3 (1knr A:238-353)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily) Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) 
Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (4 proteins) 
Protein L-aspartate oxidase [56427] (1 species) Species Escherichia coli [TaxId:562] [56428] (3 PDB entries) 
Domain d1knra3: 1knr A:238-353 [72790]
Other proteins in same PDB: d1knra1, d1knra2
Details for d1knra3
PDB Entry: 1knr (more details), 2.5 Å
PDB Description: l-aspartate oxidase: r386l mutant
SCOP Domain Sequences for d1knra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knra3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli}
lefnqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivarai
dhemkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahyt
SCOP Domain Coordinates for d1knra3:
Click to download the PDB-style file with coordinates for d1knra3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1knra3:
- d1knra3 is new in SCOP 1.61
- d1knra3 appears in SCOP 1.63
- d1knra3 appears in the current release, SCOPe 2.08
View in 3D
