Lineage for d1knra3 (1knr A:238-353)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558810Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 2558811Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 2558812Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 2558878Protein L-aspartate oxidase [56427] (1 species)
  7. 2558879Species Escherichia coli [TaxId:562] [56428] (3 PDB entries)
  8. 2558881Domain d1knra3: 1knr A:238-353 [72790]
    Other proteins in same PDB: d1knra1, d1knra2
    complexed with cl, fad, na; mutant

Details for d1knra3

PDB Entry: 1knr (more details), 2.5 Å

PDB Description: L-aspartate oxidase: R386L mutant
PDB Compounds: (A:) L-aspartate oxidase

SCOPe Domain Sequences for d1knra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knra3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli [TaxId: 562]}
lefnqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivarai
dhemkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahyt

SCOPe Domain Coordinates for d1knra3:

Click to download the PDB-style file with coordinates for d1knra3.
(The format of our PDB-style files is described here.)

Timeline for d1knra3: