Lineage for d1knra2 (1knr A:5-237,A:354-422)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176345Family c.3.1.4: Succinate dehydrogenase/fumarate reductase N-terminal domain [51934] (4 proteins)
  6. 176391Protein L-aspartate oxidase [51935] (1 species)
  7. 176392Species Escherichia coli [TaxId:562] [51936] (3 PDB entries)
  8. 176394Domain d1knra2: 1knr A:5-237,A:354-422 [72789]
    Other proteins in same PDB: d1knra1, d1knra3

Details for d1knra2

PDB Entry: 1knr (more details), 2.5 Å

PDB Description: L-aspartate oxidase: R386L mutant

SCOP Domain Sequences for d1knra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knra2 c.3.1.4 (A:5-237,A:354-422) L-aspartate oxidase {Escherichia coli}
pehscdvliigsgaaglslalrladqhqvivlskgpvtegstfyaqggiaavfdetdsid
shvedtliagagicdrhavefvasnarscvqwlidqgvlfdthiqpngeesyhltreggh
shrrilhaadatgrevettlvskalnhpnirvlertnavdlivsdkiglpgtrrvvgawv
wnrnketvetchakavvlatggaskvyqyttnpdissgdgiamawragcrvanXcggvmv
ddhgrtdveglyaigevsytglhganlmasnslleclvygwsaaeditrrmpyahdistl
ppw

SCOP Domain Coordinates for d1knra2:

Click to download the PDB-style file with coordinates for d1knra2.
(The format of our PDB-style files is described here.)

Timeline for d1knra2: