Lineage for d1knra2 (1knr A:5-237,A:354-422)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096891Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 protein domains)
  6. 2096957Protein L-aspartate oxidase [51935] (1 species)
  7. 2096958Species Escherichia coli [TaxId:562] [51936] (3 PDB entries)
  8. 2096960Domain d1knra2: 1knr A:5-237,A:354-422 [72789]
    Other proteins in same PDB: d1knra1, d1knra3
    complexed with cl, fad, na; mutant

Details for d1knra2

PDB Entry: 1knr (more details), 2.5 Å

PDB Description: L-aspartate oxidase: R386L mutant
PDB Compounds: (A:) L-aspartate oxidase

SCOPe Domain Sequences for d1knra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knra2 c.3.1.4 (A:5-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]}
pehscdvliigsgaaglslalrladqhqvivlskgpvtegstfyaqggiaavfdetdsid
shvedtliagagicdrhavefvasnarscvqwlidqgvlfdthiqpngeesyhltreggh
shrrilhaadatgrevettlvskalnhpnirvlertnavdlivsdkiglpgtrrvvgawv
wnrnketvetchakavvlatggaskvyqyttnpdissgdgiamawragcrvanXcggvmv
ddhgrtdveglyaigevsytglhganlmasnslleclvygwsaaeditrrmpyahdistl
ppw

SCOPe Domain Coordinates for d1knra2:

Click to download the PDB-style file with coordinates for d1knra2.
(The format of our PDB-style files is described here.)

Timeline for d1knra2: