Lineage for d1knra1 (1knr A:423-533)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211240Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 211274Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 211275Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 211299Protein L-aspartate oxidase [46979] (1 species)
  7. 211300Species Escherichia coli [TaxId:562] [46980] (3 PDB entries)
  8. 211302Domain d1knra1: 1knr A:423-533 [72788]
    Other proteins in same PDB: d1knra2, d1knra3
    complexed with cl, fad, na; mutant

Details for d1knra1

PDB Entry: 1knr (more details), 2.5 Å

PDB Description: l-aspartate oxidase: r386l mutant

SCOP Domain Sequences for d1knra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knra1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli}
desrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyahfr
vsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp

SCOP Domain Coordinates for d1knra1:

Click to download the PDB-style file with coordinates for d1knra1.
(The format of our PDB-style files is described here.)

Timeline for d1knra1: