Lineage for d1knqa_ (1knq A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1848944Family c.37.1.17: Gluconate kinase [75195] (1 protein)
    similar to the nucleotide/nucleoside kinases
    automatically mapped to Pfam PF01202
  6. 1848945Protein Gluconate kinase [75196] (1 species)
  7. 1848946Species Escherichia coli [TaxId:562] [75197] (6 PDB entries)
  8. 1848947Domain d1knqa_: 1knq A: [72786]
    complexed with cl

Details for d1knqa_

PDB Entry: 1knq (more details), 2 Å

PDB Description: crystal structure of gluconate kinase
PDB Compounds: (A:) Gluconate kinase

SCOPe Domain Sequences for d1knqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}
ttnhdhhiyvlmgvsgsgksavasevahqlhaafldgdflhprrniekmasgeplndddr
kpwlqalndaafamqrtnkvslivcsalkkhyrdllregnpnlsfiylkgdfdviesrlk
arkghffktqmlvtqfetlqepgadetdvlvvdidqplegvvastievikk

SCOPe Domain Coordinates for d1knqa_:

Click to download the PDB-style file with coordinates for d1knqa_.
(The format of our PDB-style files is described here.)

Timeline for d1knqa_: