Lineage for d1knpa3 (1knp A:238-353)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234542Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 2234543Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 2234544Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 2234610Protein L-aspartate oxidase [56427] (1 species)
  7. 2234611Species Escherichia coli [TaxId:562] [56428] (3 PDB entries)
  8. 2234614Domain d1knpa3: 1knp A:238-353 [72785]
    Other proteins in same PDB: d1knpa1, d1knpa2
    complexed with fad, na, sin; mutant

Details for d1knpa3

PDB Entry: 1knp (more details), 2.6 Å

PDB Description: E. coli L-aspartate oxidase: mutant R386L in complex with succinate
PDB Compounds: (A:) L-aspartate oxidase

SCOPe Domain Sequences for d1knpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knpa3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli [TaxId: 562]}
lefnqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivarai
dhemkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahyt

SCOPe Domain Coordinates for d1knpa3:

Click to download the PDB-style file with coordinates for d1knpa3.
(The format of our PDB-style files is described here.)

Timeline for d1knpa3: