Lineage for d1knpa3 (1knp A:238-353)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily) Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) 
Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (4 proteins) 
Protein L-aspartate oxidase [56427] (1 species) Species Escherichia coli [TaxId:562] [56428] (3 PDB entries) 
Domain d1knpa3: 1knp A:238-353 [72785]
Other proteins in same PDB: d1knpa1, d1knpa2
Details for d1knpa3
PDB Entry: 1knp (more details), 2.6 Å
PDB Description: e. coli l-aspartate oxidase: mutant r386l in complex with succinate
SCOP Domain Sequences for d1knpa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knpa3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli}
lefnqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivarai
dhemkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahyt
SCOP Domain Coordinates for d1knpa3:
Click to download the PDB-style file with coordinates for d1knpa3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1knpa3:
- d1knpa3 is new in SCOP 1.61
- d1knpa3 appears in SCOP 1.63
- d1knpa3 appears in the current release, SCOPe 2.08
View in 3D
