Lineage for d1knpa1 (1knp A:423-533)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724459Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 1724460Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 1724492Protein L-aspartate oxidase [46979] (1 species)
  7. 1724493Species Escherichia coli [TaxId:562] [46980] (3 PDB entries)
  8. 1724496Domain d1knpa1: 1knp A:423-533 [72783]
    Other proteins in same PDB: d1knpa2, d1knpa3
    complexed with fad, na, sin; mutant

Details for d1knpa1

PDB Entry: 1knp (more details), 2.6 Å

PDB Description: e. coli l-aspartate oxidase: mutant r386l in complex with succinate
PDB Compounds: (A:) L-aspartate oxidase

SCOPe Domain Sequences for d1knpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knpa1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli [TaxId: 562]}
desrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyahfr
vsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp

SCOPe Domain Coordinates for d1knpa1:

Click to download the PDB-style file with coordinates for d1knpa1.
(The format of our PDB-style files is described here.)

Timeline for d1knpa1: