Lineage for d1knma_ (1knm A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061886Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2061887Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2062026Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 2062027Species Streptomyces lividans [TaxId:1916] [74958] (3 PDB entries)
  8. 2062028Domain d1knma_: 1knm A: [72781]
    complexed with gol, lat

Details for d1knma_

PDB Entry: 1knm (more details), 1.2 Å

PDB Description: streptomyces lividans xylan binding domain cbm13 in complex with lactose
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d1knma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]}
ppadggqikgvgsgrcldvpdastsdgtqlqlwdchsgtnqqwaatdagelrvygdkcld
aagtsngskvqiyscwggdnqkwrlnsdgsvvgvqsglcldavgngtangtliqlytcsn
gsnqrwtrt

SCOPe Domain Coordinates for d1knma_:

Click to download the PDB-style file with coordinates for d1knma_.
(The format of our PDB-style files is described here.)

Timeline for d1knma_: