Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species) |
Species Streptomyces lividans [TaxId:1916] [74958] (3 PDB entries) |
Domain d1knma_: 1knm A: [72781] complexed with gol, lat |
PDB Entry: 1knm (more details), 1.2 Å
SCOPe Domain Sequences for d1knma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} ppadggqikgvgsgrcldvpdastsdgtqlqlwdchsgtnqqwaatdagelrvygdkcld aagtsngskvqiyscwggdnqkwrlnsdgsvvgvqsglcldavgngtangtliqlytcsn gsnqrwtrt
Timeline for d1knma_: