Class b: All beta proteins [48724] (141 folds) |
Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) |
Family b.42.2.1: Ricin B-like [50371] (3 proteins) |
Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species) |
Species Streptomyces lividans [TaxId:1916] [74958] (3 PDB entries) |
Domain d1knla_: 1knl A: [72780] complexed with gol |
PDB Entry: 1knl (more details), 1.2 Å
SCOP Domain Sequences for d1knla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knla_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans} dggqikgvgsgrcldvpdastsdgtqlqlwdchsgtnqqwaatdagelrvygdkcldaag tsngskvqiyscwggdnqkwrlnsdgsvvgvqsglcldavgngtangtliqlytcsngsn qrwtrt
Timeline for d1knla_: