Lineage for d1knla_ (1knl A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375486Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 375487Family b.42.2.1: Ricin B-like [50371] (3 proteins)
  6. 375524Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 375525Species Streptomyces lividans [TaxId:1916] [74958] (3 PDB entries)
  8. 375527Domain d1knla_: 1knl A: [72780]
    complexed with gol

Details for d1knla_

PDB Entry: 1knl (more details), 1.2 Å

PDB Description: Streptomyces lividans Xylan Binding Domain cbm13

SCOP Domain Sequences for d1knla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knla_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans}
dggqikgvgsgrcldvpdastsdgtqlqlwdchsgtnqqwaatdagelrvygdkcldaag
tsngskvqiyscwggdnqkwrlnsdgsvvgvqsglcldavgngtangtliqlytcsngsn
qrwtrt

SCOP Domain Coordinates for d1knla_:

Click to download the PDB-style file with coordinates for d1knla_.
(The format of our PDB-style files is described here.)

Timeline for d1knla_: