SCOP 1.65: Domain d1knfa2: 1knf A:133-289

Lineage for d1knfa2 (1knf A:133-289)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)

7. Species Burkholderia cepacia (formerly Pseudomonas cepacia) [54605] (6 PDB entries)

8. Domain d1knfa2: 1knf A:133-289 [72776]
   complexed with fe2, mbd, tbu

Details for d1knfa2

PDB Entry: 1knf, 1.9 Å

PDB Description: Crystal Structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase Complexed with 3-methyl Catechol under Anaerobic Condition

SCOP Domain Sequences for d1knfa2:

Sequence; same for both SEQRES and ATOM records:

>d1knfa2 d.32.1.3 (A:133-289) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia (formerly Pseudomonas cepacia)}
avsgfltgeqglghfvrcvpdsdkalafytdvlgfqlsdvidmkmgpdvtvpayflhcne
rhhtlaiaafplpkrihhfmlevaslddvgfafdrvdadglitstlgrhtndhmvsfyas
tpsgveveygwsartvdrswvvvrhdspsmwghksvr

Timeline for d1knfa2:

• d1knfa2 first appeared in SCOP 1.61
  
• d1knfa2 appears in SCOP 1.63
  
• d1knfa2 appears in SCOP 1.67
  
• d1knfa2 appears in the current release, SCOPe 2.08