Lineage for d1knfa1 (1knf A:2-132)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) 
Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins) Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species) Species Burkholderia cepacia (formerly Pseudomonas cepacia) [54605] (4 PDB entries) 
Domain d1knfa1: 1knf A:2-132 [72775]
Details for d1knfa1
PDB Entry: 1knf (more details), 1.9 Å
PDB Description: Crystal Structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase Complexed with 3-methyl Catechol under Anaerobic Condition
SCOP Domain Sequences for d1knfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knfa1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia (formerly Pseudomonas cepacia)}
sirslgymgfavsdvaawrsfltqklglmeagttdngdlfridsrawriavqqgevddla
fagyevadaaglaqmadklkqagiavttgdaslarrrgvtglitfadpfglpleiyygas
evfekpflpga
SCOP Domain Coordinates for d1knfa1:
Click to download the PDB-style file with coordinates for d1knfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1knfa1:
- d1knfa1 is new in SCOP 1.61
- d1knfa1 appears in SCOP 1.63
- d1knfa1 appears in the current release, SCOPe 2.08
View in 3D
