Lineage for d1knea_ (1kne A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055542Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2055586Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2055631Protein Heterochromatin protein 1, HP1 [54166] (4 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 2055635Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75343] (3 PDB entries)
    Uniprot P05205 23-74
  8. 2055638Domain d1knea_: 1kne A: [72774]
    Chromo domain complexed with histone h3 tail containing trimethyllysine 9

Details for d1knea_

PDB Entry: 1kne (more details), 2.4 Å

PDB Description: chromo domain of hp1 complexed with histone h3 tail containing trimethyllysine 9
PDB Compounds: (A:) heterochromatin protein 1

SCOPe Domain Sequences for d1knea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knea_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
eyavekiidrrvrkgmveyylkwkgypetentwepennldcqdliqqyeasr

SCOPe Domain Coordinates for d1knea_:

Click to download the PDB-style file with coordinates for d1knea_.
(The format of our PDB-style files is described here.)

Timeline for d1knea_: