Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein Heterochromatin protein 1, HP1 [54166] (4 species) duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75343] (3 PDB entries) Uniprot P05205 23-74 |
Domain d1knea_: 1kne A: [72774] Chromo domain complexed with histone h3 tail containing trimethyllysine 9 |
PDB Entry: 1kne (more details), 2.4 Å
SCOPe Domain Sequences for d1knea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knea_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} eyavekiidrrvrkgmveyylkwkgypetentwepennldcqdliqqyeasr
Timeline for d1knea_: