SCOPe 2.08: Domain d1knea_: 1kne A:

Lineage for d1knea_ (1kne A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein Heterochromatin protein 1, HP1 [54166] (4 species)
   duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75343] (3 PDB entries)
   Uniprot P05205 23-74

8. Domain d1knea_: 1kne A: [72774]
   Chromo domain complexed with histone h3 tail containing trimethyllysine 9

Details for d1knea_

PDB Entry: 1kne, 2.4 Å

PDB Description: chromo domain of hp1 complexed with histone h3 tail containing trimethyllysine 9

PDB Compounds: (A:) heterochromatin protein 1

SCOPe Domain Sequences for d1knea_:

Sequence; same for both SEQRES and ATOM records:

>d1knea_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
eyavekiidrrvrkgmveyylkwkgypetentwepennldcqdliqqyeasr

Timeline for d1knea_:

• d1knea_ first appeared in SCOP 1.61
  
• d1knea_ appears in SCOPe 2.07