Lineage for d1knda2 (1knd A:133-289)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327552Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 327553Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 327617Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 327618Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)
  7. 327619Species Burkholderia cepacia (formerly Pseudomonas cepacia) [54605] (6 PDB entries)
  8. 327629Domain d1knda2: 1knd A:133-289 [72773]
    complexed with caq, fe2, tbu

Details for d1knda2

PDB Entry: 1knd (more details), 1.9 Å

PDB Description: Crystal Structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase Complexed with Catechol under Anaerobic Condition

SCOP Domain Sequences for d1knda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knda2 d.32.1.3 (A:133-289) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia (formerly Pseudomonas cepacia)}
avsgfltgeqglghfvrcvpdsdkalafytdvlgfqlsdvidmkmgpdvtvpayflhcne
rhhtlaiaafplpkrihhfmlevaslddvgfafdrvdadglitstlgrhtndhmvsfyas
tpsgveveygwsartvdrswvvvrhdspsmwghksvr

SCOP Domain Coordinates for d1knda2:

Click to download the PDB-style file with coordinates for d1knda2.
(The format of our PDB-style files is described here.)

Timeline for d1knda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1knda1