Lineage for d1kn4l1 (1kn4 L:1-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287841Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)
  8. 287880Domain d1kn4l1: 1kn4 L:1-107 [72767]
    Other proteins in same PDB: d1kn4h1, d1kn4h2, d1kn4l2
    part of Fab D2.3
    complexed with pde, zn

Details for d1kn4l1

PDB Entry: 1kn4 (more details), 1.9 Å

PDB Description: catalytic antibody d2.3 complex

SCOP Domain Sequences for d1kn4l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kn4l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleil

SCOP Domain Coordinates for d1kn4l1:

Click to download the PDB-style file with coordinates for d1kn4l1.
(The format of our PDB-style files is described here.)

Timeline for d1kn4l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kn4l2