SCOP 1.71: Domain d1kn2h1: 1kn2 H:1-113

Lineage for d1kn2h1 (1kn2 H:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1kn2h1: 1kn2 H:1-113 [72760]
   Other proteins in same PDB: d1kn2h2, d1kn2l1, d1kn2l2
   part of Fab D2.3
   complexed with pne, zn

Details for d1kn2h1

PDB Entry: 1kn2, 1.9 Å

PDB Description: catalytic antibody d2.3 complex

SCOP Domain Sequences for d1kn2h1:

Sequence; same for both SEQRES and ATOM records:

>d1kn2h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
vss

Timeline for d1kn2h1:

• d1kn2h1 first appeared in SCOP 1.61
  
• d1kn2h1 appears in SCOP 1.69
  
• d1kn2h1 appears in SCOP 1.73
  
• d1kn2h1 appears in the current release, SCOPe 2.08