SCOP 1.61: Domain d1kmza_: 1kmz A:

Lineage for d1kmza_ (1kmz A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (2 proteins)

6. Protein Mitomycin resictance protein D, MRD [75394] (1 species)

7. Species Streptomyces lavendulae [TaxId:1914] [75395] (2 PDB entries)

8. Domain d1kmza_: 1kmz A: [72759]

Details for d1kmza_

PDB Entry: 1kmz, 1.5 Å

PDB Description: molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative

SCOP Domain Sequences for d1kmza_:

Sequence, based on SEQRES records:

>d1kmza_ d.32.1.2 (A:) Mitomycin resictance protein D, MRD {Streptomyces lavendulae}
arislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsydp
ewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgnv
vdlfaplp

Sequence, based on observed residues (ATOM records):

>d1kmza_ d.32.1.2 (A:) Mitomycin resictance protein D, MRD {Streptomyces lavendulae}
arislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsydp
ewqaghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgnvvdl
faplp

Timeline for d1kmza_:

• d1kmza_ is new in SCOP 1.61
  
• d1kmza_ appears in SCOP 1.63
  
• d1kmza_ appears in the current release, SCOPe 2.08