Lineage for d1kmpa_ (1kmp A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627626Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2627820Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 2627851Protein Outer membrane transporter FecA [75654] (1 species)
  7. 2627852Species Escherichia coli [TaxId:562] [75655] (5 PDB entries)
  8. 2627856Domain d1kmpa_: 1kmp A: [72754]
    complexed with cit, fe, lda

Details for d1kmpa_

PDB Entry: 1kmp (more details), 2.5 Å

PDB Description: crystal structure of the outer membrane transporter feca complexed with ferric citrate
PDB Compounds: (A:) Iron(III) dicitrate transport protein fecA

SCOPe Domain Sequences for d1kmpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmpa_ f.4.3.3 (A:) Outer membrane transporter FecA {Escherichia coli [TaxId: 562]}
ndvfehagardvirredfaktgattmrevlnripgvsapenngtgshdlamnfgirglnp
rlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrgggavrygpqsvggvvnf
vtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgtallysgtrgsdwre
hsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradydadrwqstrpydrfw
grrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlsprnywvrgieprysqi
fmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdtrsgteahawylddk
idignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyhltdswnlyantegs
fgtvqysqigkavqsgnvepekartwelgtryddgaltaemglflinfnnqydsnqtndt
vtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirekgdtygnlvpfspkh
kgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripgfmlwgarvaydfgp
qmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslkf

SCOPe Domain Coordinates for d1kmpa_:

Click to download the PDB-style file with coordinates for d1kmpa_.
(The format of our PDB-style files is described here.)

Timeline for d1kmpa_: