Lineage for d1kmoa_ (1kmo A:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 202092Fold f.4: Transmembrane beta-barrels [56924] (4 superfamilies)
  4. 202117Superfamily f.4.3: Porins [56935] (3 families) (S)
  5. 202186Family f.4.3.3: Ligand-gated protein channel [56948] (3 proteins)
  6. 202201Protein Outer membrane transporter FecA [75654] (1 species)
  7. 202202Species Escherichia coli [TaxId:562] [75655] (2 PDB entries)
  8. 202203Domain d1kmoa_: 1kmo A: [72753]

Details for d1kmoa_

PDB Entry: 1kmo (more details), 2 Å

PDB Description: crystal structure of the outer membrane transporter feca

SCOP Domain Sequences for d1kmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmoa_ f.4.3.3 (A:) Outer membrane transporter FecA {Escherichia coli}
altvvgdwlgdarendvfehagardvirredfaktgattmrevlnripgvsapenngtgs
hdlamnfgirglnprlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrggga
vrygpqsvggvvnfvtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgt
allysgtrgsdwrehsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradyd
adrwqstrpydrfwgrrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlspr
nywvrgieprysqifmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdt
rsgteahawylddkidignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyh
ltdswnlyantegsfgtvqysqigkavqsgnvepekartwelgtryddgaltaemglfli
nfnnqydsnqtndtvtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirek
gdtygnlvpfspkhkgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripg
fmlwgarvaydfgpqmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslk
f

SCOP Domain Coordinates for d1kmoa_:

Click to download the PDB-style file with coordinates for d1kmoa_.
(The format of our PDB-style files is described here.)

Timeline for d1kmoa_: