Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (9 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species) |
Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [64024] (2 PDB entries) |
Domain d1kmhb3: 1kmh B:98-377 [72750] Other proteins in same PDB: d1kmha1, d1kmha2, d1kmhb1, d1kmhb2 complexed with ttx |
PDB Entry: 1kmh (more details), 3.4 Å
SCOP Domain Sequences for d1kmhb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmhb3 c.37.1.11 (B:98-377) Central domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast} lsvpvggptlgrifnvlgepvdnlrpvdtrttspihrsapaftqldtklsifetgikvvn llapyrrggkiglfggagvgktvlimelinniakahggvsvfggvgertregndlymemk esgvineqniaeskvalvygqmneppgarmrvgltaltmaeyfrdvneqdvllfidnifr fvqagsevsallgrmpsavgyqptlstemgslqeritstkegsitsiqavyvpaddltdp apattfahldattvlsrglaakgiypavdpldststmlqp
Timeline for d1kmhb3: