SCOP 1.63: Domain d1kmhb3: 1kmh B:98-377

Lineage for d1kmhb3 (1kmh B:98-377)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (9 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [64024] (2 PDB entries)

8. Domain d1kmhb3: 1kmh B:98-377 [72750]
   Other proteins in same PDB: d1kmha1, d1kmha2, d1kmhb1, d1kmhb2
   complexed with ttx

Details for d1kmhb3

PDB Entry: 1kmh, 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin

SCOP Domain Sequences for d1kmhb3:

Sequence; same for both SEQRES and ATOM records:

>d1kmhb3 c.37.1.11 (B:98-377) Central domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
lsvpvggptlgrifnvlgepvdnlrpvdtrttspihrsapaftqldtklsifetgikvvn
llapyrrggkiglfggagvgktvlimelinniakahggvsvfggvgertregndlymemk
esgvineqniaeskvalvygqmneppgarmrvgltaltmaeyfrdvneqdvllfidnifr
fvqagsevsallgrmpsavgyqptlstemgslqeritstkegsitsiqavyvpaddltdp
apattfahldattvlsrglaakgiypavdpldststmlqp

Timeline for d1kmhb3:

• d1kmhb3 first appeared in SCOP 1.61
  
• d1kmhb3 appears in SCOP 1.65
  
• d1kmhb3 appears in the current release, SCOPe 2.08