Lineage for d1kmhb2 (1kmh B:19-97)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377221Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 377222Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 377223Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 377263Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 377299Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88681] (2 PDB entries)
  8. 377300Domain d1kmhb2: 1kmh B:19-97 [72749]
    Other proteins in same PDB: d1kmha1, d1kmha2, d1kmha3, d1kmhb1, d1kmhb3
    complexed with ttx

Details for d1kmhb2

PDB Entry: 1kmh (more details), 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin

SCOP Domain Sequences for d1kmhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmhb2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast}
nlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrava
msatdgltrgmevidtgap

SCOP Domain Coordinates for d1kmhb2:

Click to download the PDB-style file with coordinates for d1kmhb2.
(The format of our PDB-style files is described here.)

Timeline for d1kmhb2: