SCOP 1.61: Domain d1kmhb2: 1kmh B:19-97

Lineage for d1kmhb2 (1kmh B:19-97)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63793] (2 PDB entries)

8. Domain d1kmhb2: 1kmh B:19-97 [72749]
   Other proteins in same PDB: d1kmha1, d1kmha3, d1kmhb1, d1kmhb3

Details for d1kmhb2

PDB Entry: 1kmh, 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin

SCOP Domain Sequences for d1kmhb2:

Sequence; same for both SEQRES and ATOM records:

>d1kmhb2 b.49.1.1 (B:19-97) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
nlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrava
msatdgltrgmevidtgap

Timeline for d1kmhb2:

• d1kmhb2 is new in SCOP 1.61
  
• d1kmhb2 appears in SCOP 1.63
  
• d1kmhb2 appears in the current release, SCOPe 2.08