Lineage for d1kmhb1 (1kmh B:378-485)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330430Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2330431Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2330432Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2330503Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2330618Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88932] (2 PDB entries)
  8. 2330620Domain d1kmhb1: 1kmh B:378-485 [72748]
    Other proteins in same PDB: d1kmha1, d1kmha2, d1kmha3, d1kmhb2, d1kmhb3
    complexed with ttx

Details for d1kmhb1

PDB Entry: 1kmh (more details), 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin
PDB Compounds: (B:) ATPase beta subunit

SCOPe Domain Sequences for d1kmhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmhb1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata

SCOPe Domain Coordinates for d1kmhb1:

Click to download the PDB-style file with coordinates for d1kmhb1.
(The format of our PDB-style files is described here.)

Timeline for d1kmhb1: