SCOP 1.75: Domain d1kmhb1: 1kmh B:378-485

Lineage for d1kmhb1 (1kmh B:378-485)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88932] (2 PDB entries)

8. Domain d1kmhb1: 1kmh B:378-485 [72748]
   Other proteins in same PDB: d1kmha1, d1kmha2, d1kmha3, d1kmhb2, d1kmhb3
   complexed with ttx

Details for d1kmhb1

PDB Entry: 1kmh, 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin

PDB Compounds: (B:) ATPase beta subunit

SCOP Domain Sequences for d1kmhb1:

Sequence; same for both SEQRES and ATOM records:

>d1kmhb1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv
aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata

Timeline for d1kmhb1:

• d1kmhb1 first appeared in SCOP 1.61
  
• d1kmhb1 appears in SCOP 1.73
  
• d1kmhb1 appears in SCOPe 2.01
  
• d1kmhb1 appears in the current release, SCOPe 2.08