Class a: All alpha proteins [46456] (179 folds) |
Fold a.69: Left-handed superhelix [47916] (3 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species) |
Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88932] (2 PDB entries) |
Domain d1kmhb1: 1kmh B:378-485 [72748] Other proteins in same PDB: d1kmha1, d1kmha2, d1kmha3, d1kmhb2, d1kmhb3 complexed with ttx |
PDB Entry: 1kmh (more details), 3.4 Å
SCOP Domain Sequences for d1kmhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmhb1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast} rivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffv aevftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata
Timeline for d1kmhb1: