Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species) |
Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88778] (2 PDB entries) |
Domain d1kmha3: 1kmh A:97-372 [72747] Other proteins in same PDB: d1kmha1, d1kmha2, d1kmhb1, d1kmhb2, d1kmhb3 complexed with ttx |
PDB Entry: 1kmh (more details), 3.4 Å
SCOPe Domain Sequences for d1kmha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmha3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} qipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvyeplqtgliaida mipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkassvaqvvtnfqer gameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddlskqaqayrqmsl llrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqagdvsayiptnvi sitdgqiflsadlfnagirpainvgisvsrvgsaaq
Timeline for d1kmha3: