Lineage for d1kmha3 (1kmh A:97-372)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394452Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (12 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 394505Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 394541Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88778] (2 PDB entries)
  8. 394542Domain d1kmha3: 1kmh A:97-372 [72747]
    Other proteins in same PDB: d1kmha1, d1kmha2, d1kmhb1, d1kmhb2, d1kmhb3
    complexed with ttx

Details for d1kmha3

PDB Entry: 1kmh (more details), 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin

SCOP Domain Sequences for d1kmha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmha3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
qipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvyeplqtgliaida
mipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkassvaqvvtnfqer
gameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddlskqaqayrqmsl
llrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqagdvsayiptnvi
sitdgqiflsadlfnagirpainvgisvsrvgsaaq

SCOP Domain Coordinates for d1kmha3:

Click to download the PDB-style file with coordinates for d1kmha3.
(The format of our PDB-style files is described here.)

Timeline for d1kmha3: