Lineage for d1kmha3 (1kmh A:97-372)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179955Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 180008Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 180070Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [64024] (2 PDB entries)
  8. 180073Domain d1kmha3: 1kmh A:97-372 [72747]
    Other proteins in same PDB: d1kmha1, d1kmha2, d1kmhb1, d1kmhb2

Details for d1kmha3

PDB Entry: 1kmh (more details), 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin

SCOP Domain Sequences for d1kmha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmha3 c.37.1.11 (A:97-372) Central domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
qipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvyeplqtgliaida
mipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkassvaqvvtnfqer
gameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddlskqaqayrqmsl
llrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqagdvsayiptnvi
sitdgqiflsadlfnagirpainvgisvsrvgsaaq

SCOP Domain Coordinates for d1kmha3:

Click to download the PDB-style file with coordinates for d1kmha3.
(The format of our PDB-style files is described here.)

Timeline for d1kmha3: