Lineage for d1kmha2 (1kmh A:25-96)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795773Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1795774Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 1795825Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88676] (2 PDB entries)
  8. 1795827Domain d1kmha2: 1kmh A:25-96 [72746]
    Other proteins in same PDB: d1kmha1, d1kmha3, d1kmhb1, d1kmhb2, d1kmhb3
    complexed with ttx

Details for d1kmha2

PDB Entry: 1kmh (more details), 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin
PDB Compounds: (A:) ATPase alpha subunit

SCOPe Domain Sequences for d1kmha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmha2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
egssvkatgria

SCOPe Domain Coordinates for d1kmha2:

Click to download the PDB-style file with coordinates for d1kmha2.
(The format of our PDB-style files is described here.)

Timeline for d1kmha2: