Class b: All beta proteins [48724] (176 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88676] (2 PDB entries) |
Domain d1kmha2: 1kmh A:25-96 [72746] Other proteins in same PDB: d1kmha1, d1kmha3, d1kmhb1, d1kmhb2, d1kmhb3 complexed with ttx |
PDB Entry: 1kmh (more details), 3.4 Å
SCOPe Domain Sequences for d1kmha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmha2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq egssvkatgria
Timeline for d1kmha2: