SCOP 1.63: Domain d1kmha2: 1kmh A:25-96

Lineage for d1kmha2 (1kmh A:25-96)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [63793] (2 PDB entries)

8. Domain d1kmha2: 1kmh A:25-96 [72746]
   Other proteins in same PDB: d1kmha1, d1kmha3, d1kmhb1, d1kmhb3

Details for d1kmha2

PDB Entry: 1kmh, 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin

SCOP Domain Sequences for d1kmha2:

Sequence; same for both SEQRES and ATOM records:

>d1kmha2 b.49.1.1 (A:25-96) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast}
kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
egssvkatgria

Timeline for d1kmha2:

• d1kmha2 first appeared in SCOP 1.61
  
• d1kmha2 appears in SCOP 1.65
  
• d1kmha2 appears in the current release, SCOPe 2.08