SCOPe 2.08: Domain d1kmha1: 1kmh A:373-501

Lineage for d1kmha1 (1kmh A:373-501)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)

7. Species Spinach (Spinacia oleracea), chloroplast [TaxId:3562] [88927] (2 PDB entries)

8. Domain d1kmha1: 1kmh A:373-501 [72745]
   Other proteins in same PDB: d1kmha2, d1kmha3, d1kmhb1, d1kmhb2, d1kmhb3
   complexed with ttx

Details for d1kmha1

PDB Entry: 1kmh, 3.4 Å

PDB Description: crystal structure of spinach chloroplast f1-atpase complexed with tentoxin

PDB Compounds: (A:) ATPase alpha subunit

SCOPe Domain Sequences for d1kmha1:

Sequence; same for both SEQRES and ATOM records:

>d1kmha1 a.69.1.1 (A:373-501) F1 ATP synthase alpha subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}
ikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqsapltve
eqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstktfteeaeallke
aiqeqmerf

Timeline for d1kmha1:

• d1kmha1 first appeared in SCOP 1.61
  
• d1kmha1 appears in SCOPe 2.07